Calsyntenin 1 anticorps (N-Term)

N° du produit ABIN635351

L’anticorps Lapin Polyclonal anti-Calsyntenin 1 a été validé pour WB. Il convient pour détecter Calsyntenin 1 dans des échantillons de Humain.

Aperçu rapide pour Calsyntenin 1 anticorps (N-Term) (ABIN635351)

Antigène: Calsyntenin 1 (CLSTN1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calsyntenin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Calsyntenin 1 anticorps

Épitope: N-Term

Specificité: Calsyntenin 1 antibody was raised against the N terminal of CLSTN1

Purification: Affinity purified

Immunogène: Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calsyntenin 1 Blocking Peptide, (ABIN939985), is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calsyntenin 1

Antigène: Calsyntenin 1 (CLSTN1)

Autre désignation: Calsyntenin 1

Sujet: CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Poids moléculaire: 110 kDa (MW of target protein)